missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYBB/NOX2 Antibody [Alexa Fluor« 532], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-36716AF532
This item is not returnable.
View return policy
Description
CYBB/NOX2 Polyclonal antibody specifically detects CYBB/NOX2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| CYBB/NOX2 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| Alexa Fluor 532 | |
| CGD, CGD91-phox, Cytochrome b(558) subunit beta, cytochrome b-245 heavy chain, cytochrome b-245, beta polypeptide, Cytochrome b558 subunit beta, EC 1.6.3, GP91-1, GP91PHOX, GP91-PHOX, Heme-binding membrane glycoprotein gp91phox, NADPH oxidase 2, Neutrophil cytochrome b 91 kDa polypeptide, NOX2chronic granulomatous disease, p22 phagocyte B-cytochrome, p91-PHOX, Superoxide-generating NADPH oxidase heavy chain subunit | |
| A synthetic peptide corresponding to a sequence within amino acids 101-200 of human CYBB/NOX2 (NP_000388.2).,, Sequence:, FHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRS | |
| 0.1 mL | |
| Cancer, Endocrinology, Immunology | |
| 1536 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction