missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MS4A8B Antibody [DyLight 755], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35124IR
This item is not returnable.
View return policy
Description
MS4A8B Polyclonal antibody specifically detects MS4A8B in Human samples. It is validated for ELISA,Western Blot
Specifications
| MS4A8B | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 83661 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot | |
| DyLight 755 | |
| 4SPAN4, Four-span transmembrane protein 4, membrane-spanning 4-domains subfamily A member 8B, membrane-spanning 4-domains, subfamily A, member 8B, MS4A4 | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A8B (NP_113645.1).,, Sequence:, SISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIAC | |
| 0.1 mL | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction