missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HLA DPB1 Antibody [PE], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35275PE
This item is not returnable.
View return policy
Description
HLA DPB1 Polyclonal antibody specifically detects HLA DPB1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
| HLA DPB1 | |
| Polyclonal | |
| PBS | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| PE | |
| DP beta 1 chain, DPB1, HLA class II histocompatibility antigen, DP(W4) beta chain, HLA DP14-beta chain, HLA-DP histocompatibility type, beta-1 subunit, HLA-DP1B, HLA-DPB, major histocompatibility complex class II HLA DPB1 protein, major histocompatibility complex, class II, DP beta 1, MHC class II antigen beta chain, MHC class II antigen DP beta 1 chain, MHC class II antigen DPB1, MHC class II antigen DPbeta1, MHC class II HLA-DP-beta, MHC HLA DPB1 | |
| A synthetic peptide corresponding to a sequence within amino acids 40-100 of human HLA DPB1 (NP_002112.3).,, Sequence:, GRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRA | |
| 0.1 mL | |
| Asthma, Diabetes Research, Immunology | |
| 3115 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction