missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPC25 Antibody [FITC], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35159F
This item is not returnable.
View return policy
Description
SPC25 Polyclonal antibody specifically detects SPC25 in Human samples. It is validated for ELISA,Western Blot
Specifications
| SPC25 | |
| Polyclonal | |
| PBS | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 57405 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot | |
| FITC | |
| AD024, hSpc25, kinetochore protein Spc25, MGC22228,2600017H08Rik, SPBC25, SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae), spindle pole body component 25 homolog, spindle pole body component 25 homolog (S. cerevisiae) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 120-224 of human SPC25 (NP_065726.1).,, Sequence:, ANKANAERLKRLQKSADLYKDRLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVYN | |
| 0.1 mL | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction