missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAJC19 Antibody [Biotin], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP3-38125B
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
DNAJC19 Polyclonal antibody specifically detects DNAJC19 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Spécification
| DNAJC19 | |
| Polyclonal | |
| PBS | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Biotin | |
| DnaJ (Hsp40) homolog, subfamily C, member 19, DnaJ homolog subfamily C member 19, homolog of yeast TIM14, mitochondrial import inner membrane translocase subunit TIM14, Tim14, TIMM14TIM14Pam18 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DNAJC19 (NP_660304.1).,, Sequence:, MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK | |
| 0.1 mL | |
| Vision | |
| 131118 | |
| Store at 4°C in the dark. | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu