missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USP13 Antibody [Alexa Fluor« 647], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35117AF647
This item is not returnable.
View return policy
Description
USP13 Polyclonal antibody specifically detects USP13 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| USP13 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 8975 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot | |
| Alexa Fluor 647 | |
| Deubiquitinating enzyme 13, EC 3.1.2.15, EC 3.4.19.12, Isopeptidase T-3, ISOT-3, ISOT3IsoT-3, ubiquitin carboxyl-terminal hydrolase 13, ubiquitin specific peptidase 13 (isopeptidase T-3), ubiquitin specific protease 13 (isopeptidase T-3), ubiquitin thioesterase 13, Ubiquitin thiolesterase 13, Ubiquitin-specific-processing protease 13 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 90-200 of human USP13 (NP_003931.2).,, Sequence:, MHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDN | |
| 0.1 mL | |
| Primary | |
| Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction