missing translation for 'onlineSavingsMsg'
Learn More

CHD3 Antibody [Allophycocyanin], Novus Biologicals Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-37987APC

Product Code. 30499903

6175.00 NOK / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

CHD3 Polyclonal antibody specifically detects CHD3 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

Antigen	CHD3
Classification	Polyclonal
Formulation	PBS
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Product Type	Antibody
Isotype	IgG

Applications	ELISA, Western Blot
Conjugate	APC
Gene Alias	ATP-dependent helicase CHD3, CHD-3, chromodomain helicase DNA binding protein 3, chromodomain-helicase-DNA-binding protein 3, EC 3.6.1, EC 3.6.4.12, hZFH, Mi-2 autoantigen 240 kDa protein, Mi-2a, Mi2-ALPHA, ZFH, Zinc finger helicase, zinc-finger helicase (Snf2-like)
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1900-2000 of human CHD3 (NP_001005273.1).,, Sequence:, ERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGALVSDGLDRKEPRAGEVICIDD
Quantity	0.1 mL
Research Discipline	Immune Dysfunction, Immune System Diseases, Immunology, modENCODE Antibodies
Gene ID (Entrez)	1107
Content And Storage	Store at 4°C in the dark.
Form	Purified

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

CHD3 Antibody [Allophycocyanin], Novus Biologicals Biologicals™

Description

Specifications

Produktvorschläge

Dokumentation

Aktionen