missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IP3R1 Antibody [Janelia Fluor« 525], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37937JF525
This item is not returnable.
View return policy
Description
IP3R1 Polyclonal antibody specifically detects IP3R1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
| IP3R1 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Janelia Fluor 525 | |
| DKFZp313E1334, DKFZp313N1434, inositol 14,5-triphosphate receptor, type 1, inositol 14,5-trisphosphate receptor type 1, INSP3R1, IP3 receptor, IP3 receptor isoform 1, IP3R, IP3R 1, IP3R1, SCA15, SCA16, spinocerebellar ataxia 15, spinocerebellar ataxia 16, Type 1 inositol 14,5-trisphosphate receptor, Type 1 InsP3 receptor | |
| A synthetic peptide corresponding to a sequence within amino acids 1812-1911 of human IP3R1 (NP_001365381).,, Sequence:, SFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQP | |
| 0.1 mL | |
| Neuroscience | |
| 3708 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction