missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cullin 4a Antibody [Allophycocyanin], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38019APC
This item is not returnable.
View return policy
Description
Cullin 4a Polyclonal antibody specifically detects Cullin 4a in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
| Cullin 4a | |
| Polyclonal | |
| PBS | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence | |
| APC | |
| CUL-4A, cullin 4A, cullin-4A | |
| A synthetic peptide corresponding to a sequence within amino acids 1-300 of human Cullin 4a (NP_001008895.1).,, Sequence:, IERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLT | |
| 0.1 mL | |
| Apoptosis, Cancer, Tumor Suppressors | |
| 8451 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction