missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P4HA2 Antibody [CoraFluorÖ 1], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38083CL1
This item is not returnable.
View return policy
Description
P4HA2 Polyclonal antibody specifically detects P4HA2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
| P4HA2 | |
| Polyclonal | |
| PBS | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 8974 | |
| Store at 4°C in the dark. Do not freeze. | |
| Purified |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| CoraFluor 1 | |
| 2-oxoglutarate-4-dioxygenase subunit alpha-2, 4-PH alpha 2, 4-PH alpha-2, alpha polypeptide II, collagen prolyl 4-hydroxylase alpha(II), C-P4Halpha(II), EC 1.14.11.2, Procollagen-proline, procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), prolyl 4-hydroxylase subunit alpha-2, prolyl 4-hydroxylase, alpha polypeptide II | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 239-333 of human P4HA2 (NP_004190.1).,, Sequence:, SHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEW | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction