missing translation for 'onlineSavingsMsg'
Learn More
Learn More
![TIA1 Antibody [mFluor Violet 610 SE], Novus Biologicals Biologicals 0.1](https://assets.fishersci.com/TFS-Assets/CCG/Novus-Biologicals/antibodies/Product-Image-Alexa-Fluor-350.jpg-650.jpg)
TIA1 Antibody [mFluor Violet 610 SE], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35245MFV610
This item is not returnable.
View return policy
Description
TIA1 Polyclonal antibody specifically detects TIA1 in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
| TIA1 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Antibody | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| mFluor Violet 610 SE | |
| cytotoxic granule-associated RNA-binding protein, nucleolysin TIA-1 isoform p40, p40-TIA-1, p40-TIA-1 (containing p15-TIA-1), RNA-binding protein TIA-1, T-cell-restricted intracellular antigen-1, TIA-1, TIA1 cytotoxic granule-associated RNA binding protein, TIA1 cytotoxic granule-associated RNA-binding protein | |
| A synthetic peptide corresponding to a sequence within amino acids 287-386 of human TIA1 (NP_071505.2).,, Sequence:, IGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ | |
| 0.1 mL | |
| Adaptive Immunity, Apoptosis, Immunology | |
| 7072 | |
| Store at 4°C in the dark. | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido