missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUCKS1 Antibody [mFluor Violet 500 SE], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37908MFV500
This item is not returnable.
View return policy
Description
NUCKS1 Polyclonal antibody specifically detects NUCKS1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| NUCKS1 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 64710 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot | |
| mFluor Violet 500 SE | |
| FLJ21480, FLJ32016, FLJ38536, NUCKSnuclear ubiquitous casein and cyclin-dependent kinases substrate, nuclear casein kinase and cyclin-dependent kinase substrate 1, nuclear ubiquitous casein kinase and cyclin-dependent kinase substrate, P1, potential LAG1 interactor | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NUCKS1 (NP_073568.2).,, Sequence:, ASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKE | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction