missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30499042

KAT2A/GCN5 Antibody [Alexa Fluor« 350], Novus Biologicals Biologicals™

Product Code. 30499042 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Packungsgröße:
0.1mL
Artikelnummer. Quantity unitSize
30499042 0.1 mL 0.1mL
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30499042

Marke: Novus Biologicals NBP337988AF350

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

KAT2A/GCN5 Polyclonal antibody specifically detects KAT2A/GCN5 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen KAT2A/GCN5
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Alexa Fluor 350
Formulation 50mM Sodium Borate
Gene Alias EC 2.3.1.48, GCN5 general control of amino-acid synthesis 5-like 2 (yeast), GCN5L2GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2, GCN5MGC102791, General control of amino acid synthesis protein 5-like 2, General control of amino acid synthesis, yeast, homolog-like 2, HGCN5, Histone acetyltransferase GCN5, histone acetyltransferase KAT2A, HsGCN5, K(lysine) acetyltransferase 2A, Lysine acetyltransferase 2A, PCAF-b, STAF97
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KAT2A/GCN5 (NP_066564.2).,, Sequence:, MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRA
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing, Epigenetics, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 2648
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.