missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30499020

MNK1 Antibody [DyLight 550], Novus Biologicals Biologicals™

Product Code. 30499020 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30499020 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30499020

Brand: Novus Biologicals NBP335840R

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

MNK1 Polyclonal antibody specifically detects MNK1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen MNK1
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate DyLight 550
Formulation 50mM Sodium Borate
Gene Alias EC 2.7.11, EC 2.7.11.1, MAP kinase interacting kinase 1, MAP kinase interacting serine/threonine kinase 1, MAP kinase signal-integrating kinase 1, MAP kinase-interacting serine/threonine-protein kinase 1, Mnk1, MNK1MAP kinase-interacting serine/threonine kinase 1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 374-465 of human MNK1 (NP_003675.2).,, Sequence:, VQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Phospho Specific, Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 8569
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.