missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30498991

IRF7 Antibody [Allophycocyanin], Novus Biologicals Biologicals™

Product Code. 30498991 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30498991 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30498991

Brand: Novus Biologicals NBP335066APC

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

IRF7 Polyclonal antibody specifically detects IRF7 in Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen IRF7
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate APC
Formulation PBS
Gene Alias interferon regulatory factor 7, interferon regulatory factor-7H, IRF-7, IRF7A, IRF-7H
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IRF7 (NP_001563.2).,, Sequence:, KDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPP
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 3665
Target Species Mouse
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.