missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PAWR / PAR4 Polyclonal antibody specifically detects PAWR / PAR4 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | PAWR / PAR4 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 750 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | Par-4, PAR4prostate apoptosis response protein 4, PRKC apoptosis WT1 regulator protein, PRKC, apoptosis, WT1, regulator, Prostate apoptosis response 4 protein, prostate apoptosis response protein PAR-4, transcriptional repressor PAR4, WT1-interacting protein |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAWR/ PAR4 (NP_002574.2),, Sequence:, QNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMI |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?