missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30498796

Spike Antibody [mFluor Violet 500 SE], Novus Biologicals Biologicals™

Product Code. 30498796 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30498796 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30498796

Brand: Novus Biologicals NBP337898MFV500

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Spike Polyclonal antibody specifically detects Spike in SARS-CoV samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Spike
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate mFluor Violet 500 SE
Formulation 50mM Sodium Borate
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of coronavirus Spike S1 (NP_828851.1).,, Sequence:, MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRG
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Target Species SARS-CoV
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.