missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
USH1C Polyclonal antibody specifically detects USH1C in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | USH1C |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 647 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | AIE75, AIE-75, Antigen NY-CO-38/NY-CO-37, Autoimmune enteropathy-related antigen AIE-75, deafness, autosomal recessive 18, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-45, PDZ73, PDZ-73, PDZ-73/NY-CO-38, Protein PDZ-73, Renal carcinoma antigen NY-REN-3, ush1cpst, Usher syndrome 1C (autosomal recessive, severe), Usher syndrome type-1C protein |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of zebrafish USH1C (NP_001035018.1).,, Sequence:, MERKVAREFRHKVELLIDNEAEKDYLYDVLRMYHQSMDLPVLVGDLKLVINEPKRLPLFDAIRPLIPLKHQVQYDQLTPKRSRKLKEVRLDRTHPEGLGL |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?