missing translation for 'onlineSavingsMsg'
Learn More

HEY1 Antibody [Alexa Fluor« 700], Novus Biologicals Biologicals™

Product Code. 30498760 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30498760 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30498760

Brand: Novus Biologicals NBP335645AF700

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

HEY1 Polyclonal antibody specifically detects HEY1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen HEY1
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Alexa Fluor 700
Formulation 50mM Sodium Borate
Gene Alias basic helix-loop-helix protein OAF1, BHLHb31, Cardiovascular helix-loop-helix factor 2, CHF-2, CHF2hHRT1, Class B basic helix-loop-helix protein 31, Hairy and enhancer of split-related protein 1, hairy/enhancer-of-split related with YRPW motif 1, hairy/enhancer-of-split related with YRPW motif protein 1, Hairy-related transcription factor 1, HERP2HES-related repressor protein 1, HESR-1, HESR1MGC1274, HES-related repressor protein 2, HRT1, HRT-1OAF1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 114-129 of human HEY1 (NP_001269780.1).,, Sequence:, IIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline DNA Repair, DNA replication Transcription Translation and Splicing, Neuroscience, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 23462
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.