missing translation for 'onlineSavingsMsg'
Learn More

PAWR/ PAR4 Antibody [PerCP], Novus Biologicals Biologicals™

Product Code. 30498709 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30498709 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30498709

Brand: Novus Biologicals NBP338026PCP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PAWR / PAR4 Polyclonal antibody specifically detects PAWR / PAR4 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen PAWR / PAR4
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate PerCP
Formulation PBS
Gene Alias Par-4, PAR4prostate apoptosis response protein 4, PRKC apoptosis WT1 regulator protein, PRKC, apoptosis, WT1, regulator, Prostate apoptosis response 4 protein, prostate apoptosis response protein PAR-4, transcriptional repressor PAR4, WT1-interacting protein
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAWR/ PAR4 (NP_002574.2),, Sequence:, QNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMI
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, GPCR, Signal Transduction, Transcription Factors and Regulators, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 5074
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.