missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Septin-4 Polyclonal antibody specifically detects Septin-4 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | Septin-4 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 488 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | Apoptosis-related protein in the TGF-beta signaling pathway, ARTSPeanut-like protein 2, BRADEION, Bradeion beta, Brain protein H5, CE5B3, Cell division control-related protein 2, Cerebral protein 7, H5, hCDCREL-2SEP4, hucep-7, MART, peanut-like 2, peanut-like 2 (Drosophila), PNUTL2CE5B3 beta, septin 4, septin-4, septin-M |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Septin-4 (NP_536341.1).,, Sequence:, MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSE |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?