missing translation for 'onlineSavingsMsg'
Learn More

Caspase-12 Antibody [Alexa Fluor« 350], Novus Biologicals Biologicals™

Product Code. 30498668 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30498668 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30498668

Brand: Novus Biologicals NBP335067AF350

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Caspase-12 Polyclonal antibody specifically detects Caspase-12 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Caspase-12
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Alexa Fluor 350
Formulation 50mM Sodium Borate
Gene Alias Apoptosis Related Cysteine Protease, CASP 12, casp12, CASP12P1, Caspase 12 pseudogene 1, Caspase12, UNQ9415
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-12 (NP_001177945.2).,, Sequence:, FNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASADTHGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Caspases
Primary or Secondary Primary
Gene ID (Entrez) 100506742
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.