missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Gasdermin-C Polyclonal antibody specifically detects Gasdermin-C in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | Gasdermin-C |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | DyLight 755 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | gasdermin C, gasdermin-C, Melanoma-derived leucine zipper-containing extranuclear factor, MLZEmelanoma-derived leucine zipper, extra-nuclear factor |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Gasdermin-C (NP_113603.1).,, Sequence:, MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVG |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?