missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ACSL3 Polyclonal antibody specifically detects ACSL3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | ACSL3 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | PerCP |
| Formulation | PBS |
| Gene Alias | ACS3EC 6.2.1.3, acyl-CoA synthetase long-chain family member 3, FACL3lignoceroyl-CoA synthase, fatty-acid-Coenzyme A ligase, long-chain 3, LACS 3, LACS3, Long-chain acyl-CoA synthetase 3, long-chain-fatty-acid--CoA ligase 3, PRO2194 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 621-720 of human ACSL3 (NP_004448.2).,, Sequence:, VIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?