missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
DHX38 Polyclonal antibody specifically detects DHX38 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | DHX38 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 350 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | ATP-dependent RNA helicase DHX38, DDX38pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38, DEAH (Asp-Glu-Ala-His) box polypeptide 38, DEAH box protein 38, EC 3.6.1, EC 3.6.4.13, KIAA0224pre-mRNA splicing factor ATP-dependent RNA helicase PRP16, PRP16 homolog of S.cerevisiae, PRP16hPrp16, PRPF16 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1133-1227 of human DHX38 (NP_054722.2).,, Sequence:, VTAVDGEWLAELGPMFYSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKRSPLGSVRSTKIYTPGRKEQGEPMTPRRTPARFGL |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?