missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30498408

Collagen V Antibody [DyLight 488], Novus Biologicals Biologicals™

Product Code. 30498408 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30498408 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30498408

Brand: Novus Biologicals NBP335507G

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Collagen V Polyclonal antibody specifically detects Collagen V in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Collagen V
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate DyLight 488
Formulation 50mM Sodium Borate
Gene Alias alpha 1 type V collagen, Collagen 5, collagen alpha-1(V) chain, collagen, type V, alpha 1, Collagen-5, EC 2.7.7.6, EC 6.1.1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Collagen V (NP_000084.3).,, Sequence:, LPPLLLLLLWAPPPSRAAQPADLLKVLDFHNLPDGITKTTGFCATRRSSKGPDVAYRVTKDAQLSAPTKQLYPASAFPEDFSILTTVKAKKGSQAFLVSIY
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cell Biology, Cellular Markers, Extracellular Matrix
Primary or Secondary Primary
Gene ID (Entrez) 1289
Target Species Human, Mouse
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.