missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NEK7 Polyclonal antibody specifically detects NEK7 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | NEK7 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | APC |
| Formulation | PBS |
| Gene Alias | EC 2.7.11.1, Never in mitosis A-related kinase 7, NIMA (never in mitosis gene a)-related kinase 7, NimA-related protein kinase 7, serine/threonine-protein kinase Nek7 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 257-301 of human NEK7 (NP_598001.1).,, Sequence:, PLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTAS |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?