missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30498316

EMR1 Antibody [Janelia Fluor« 525], Novus Biologicals Biologicals™

Product Code. 30498316 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30498316 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30498316

Brand: Novus Biologicals NBP335252JF525

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

EMR1 Polyclonal antibody specifically detects EMR1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen EMR1
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Janelia Fluor 525
Formulation 50mM Sodium Borate
Gene Alias ADGRE1, egf-like module containing, mucin-like, hormone receptor-like 1, egf-like module containing, mucin-like, hormone receptor-like sequence 1, EGF-like module receptor 1, EGF-like module-containing mucin-like hormone receptor-like 1, EMR1 hormone receptor, TM7LN3
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 477-596 of human EMR1 (NP_001965.3).,, Sequence:, GVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMANLAVIMASGEL
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Adaptive Immunity, GPCR, Immune System Diseases, Immunology, Innate Immunity, Myeloid derived Suppressor Cell
Primary or Secondary Primary
Gene ID (Entrez) 2015
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.