missing translation for 'onlineSavingsMsg'
Learn More

HLA A Antibody [PE], Novus Biologicals Biologicals™

Product Code. 30498301 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30498301 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30498301

Brand: Novus Biologicals NBP337966PE

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

HLA A Polyclonal antibody specifically detects HLA A in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen HLA A
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate PE
Formulation PBS
Gene Alias A-10 alpha chain, FLJ26655, HLA class I histocompatibility antigen, A-1 alpha chain, HLA class I histocompatibility antigen, A-28 alpha chain, HLA class I histocompatibility antigen, A-9 alpha chain, HLAA, major histocompatibility complex, class I, A, MHC class I antigen A*1, MHC class I antigen A*11, MHC class I antigen A*80
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 35-285 of human HLA A (NP_002107.3).,, Sequence:, GYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIAL
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Adaptive Immunity, Cell Biology, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 3105
Target Species Human, Mouse
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.