missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30498263

GBF1 Antibody [Alexa Fluor« 532], Novus Biologicals Biologicals™

Product Code. 30498263 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30498263 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30498263

Brand: Novus Biologicals NBP335248AF532

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

GBF1 Polyclonal antibody specifically detects GBF1 in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen GBF1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 532
Formulation 50mM Sodium Borate
Gene Alias ARF1GEF, BFA-resistant GEF 1, FLJ21263, golgi brefeldin A resistant guanine nucleotide exchange factor 1, golgi-specific brefeldin A resistance factor 1, Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1, KIAA0248FLJ21500, MGC134877, MGC134878
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human GBF1 (NP_004184.1).,, Sequence:, MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLA
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8729
Target Species Human, Mouse
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.