missing translation for 'onlineSavingsMsg'
Learn More

Isoleucyl tRNA synthetase Antibody [DyLight 680], Novus Biologicals Biologicals™

Product Code. 30498253 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Product Code. Quantity
30498253 0.1 mL
1 options
This item is not returnable. View return policy

Product Code. 30498253

Brand: Novus Biologicals NBP335104FR

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Isoleucyl tRNA synthetase Polyclonal antibody specifically detects Isoleucyl tRNA synthetase in Human samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Isoleucyl tRNA synthetase
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate DyLight 680
Formulation 50mM Sodium Borate
Gene Alias EC 6.1.1, EC 6.1.1.5, FLJ20736, IARS1, ILERS, ILRS, IRS, isoleucine tRNA ligase 1, cytoplasmic, Isoleucine--tRNA ligase, isoleucyl-tRNA synthetase, isoleucyl-tRNA synthetase, cytoplasmic, PRO0785
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1158-1262 of human Isoleucyl tRNA synthetase (NP_002152.2).,, Sequence:, SAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 3376
Target Species Human
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.