missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TIA1 Polyclonal antibody specifically detects TIA1 in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | TIA1 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | DyLight 680 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | cytotoxic granule-associated RNA-binding protein, nucleolysin TIA-1 isoform p40, p40-TIA-1, p40-TIA-1 (containing p15-TIA-1), RNA-binding protein TIA-1, T-cell-restricted intracellular antigen-1, TIA-1, TIA1 cytotoxic granule-associated RNA binding protein, TIA1 cytotoxic granule-associated RNA-binding protein |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 287-386 of human TIA1 (NP_071505.2).,, Sequence:, IGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?