missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Human Coronavirus Spike S1 Antibody [Janelia Fluor« 646], Novus Biologicals Biologicals™
Shop All Bio Techne ProductsDescription
Human Coronavirus Spike S1 Polyclonal antibody specifically detects Human Coronavirus Spike S1 in HCoV-229E samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | Human Coronavirus Spike S1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Janelia Fluor 646 |
| Formulation | 50mM Sodium Borate |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1074-1173 of coronavirus Spike S1 (NP_073551.1).,, Sequence:, TGRGDCKGFSSDVLSDVIRYNLNFEENLRRGTILFKTSYGVVVFYCTNNTLVSGDAHIPFGTVLGNFYCFVNTTIGNETTSAFVGALPKTVREFVISRTGH |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Regulatory Status | RUO |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?