missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
UBL3 Polyclonal antibody specifically detects UBL3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | UBL3 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 647 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | DKFZP434K151, FLJ32018, HCG-1, hsMUB, Membrane-anchored ubiquitin-fold protein, MUB, PNSC1, Protein HCG-1, ubiquitin-like 3, ubiquitin-like protein 3 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human UBL3 (NP_009037.1).,, Sequence:, MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?