missing translation for 'onlineSavingsMsg'
Learn More
Learn More
H4 Clustered Histone 1 Antibody [Alexa Fluor« 532], Novus Biologicals Biologicals™
Shop All Bio Techne ProductsDescription
H4 Clustered Histone 1 Polyclonal antibody specifically detects H4 Clustered Histone 1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | H4 Clustered Histone 1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 532 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | H4-16;H4C11;H4C12;H4C13;H4C14;H4C15;H4C2;H4C3;H4C4;H4C5;H4C6;H4C8;H4C9;H4FA, H4F4, HIST1H4A |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human H4 Clustered Histone 1 (NP_003529.1).,, Sequence:, MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?