missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30497986

G gamma7 Antibody [FITC], Novus Biologicals Biologicals™

Product Code. 30497986 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30497986 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30497986

Brand: Novus Biologicals NBP335093F

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

G gamma7 Polyclonal antibody specifically detects G gamma7 in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen G gamma7
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate FITC
Formulation PBS
Gene Alias FLJ00058, GNGT7, guanine nucleotide binding protein (G protein), gamma 7, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human G gamma7 (NP_443079.1).,, Sequence:, MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2788
Target Species Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.