missing translation for 'onlineSavingsMsg'
Learn More

NDUFS6 Antibody [mFluor Violet 610 SE], Novus Biologicals Biologicals™

Product Code. 30497962 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30497962 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30497962

Brand: Novus Biologicals NBP338065MFV610

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

NDUFS6 Polyclonal antibody specifically detects NDUFS6 in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NDUFS6
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate mFluor Violet 610 SE
Formulation 50mM Sodium Borate
Gene Alias CI13KDA, Complex I-13kD-A, mitochondrial respiratory chain, 13-kD subunit, NADH dehydrogenase (ubiquinone) Fe-S protein 6 (13kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Qreductase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial, NADH:ubiquinone oxidoreductase NDUFS6 subunit, NADH-ubiquinone oxidoreductase 13 kDa-A subunit
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-124 of human NDUFS6 (NP_004544.1).,, Sequence:, GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 4726
Target Species Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.