missing translation for 'onlineSavingsMsg'
Learn More

NEK7 Antibody [Janelia Fluor« 549], Novus Biologicals Biologicals™

Product Code. 30497957 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
Product Code. Quantity unitSize
30497957 0.1 mL 0.10mL
1 options
This item is not returnable. View return policy

Product Code. 30497957

Brand: Novus Biologicals NBP337907JF549

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

NEK7 Polyclonal antibody specifically detects NEK7 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NEK7
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Janelia Fluor 549
Formulation 50mM Sodium Borate
Gene Alias EC 2.7.11.1, Never in mitosis A-related kinase 7, NIMA (never in mitosis gene a)-related kinase 7, NimA-related protein kinase 7, serine/threonine-protein kinase Nek7
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 257-301 of human NEK7 (NP_598001.1).,, Sequence:, PLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTAS
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 140609
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.