missing translation for 'onlineSavingsMsg'
Learn More

Cytochrome P450 1A1 Antibody [mFluor Violet 450 SE], Novus Biologicals Biologicals™

Product Code. 30497942 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30497942 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30497942

Brand: Novus Biologicals NBP337955MFV450

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Cytochrome P450 1A1 Polyclonal antibody specifically detects Cytochrome P450 1A1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cytochrome P450 1A1
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate mFluor Violet 450 SE
Formulation 50mM Sodium Borate
Gene Alias AHH, AHRR, aryl hydrocarbon hydroxylase, CP11, CYP1, CYPIA1, cytochrome P1-450, dioxin-inducible, cytochrome P450 1A1, Cytochrome P450 form 6, cytochrome P450, family 1, subfamily A, polypeptide 1, Cytochrome P450-C, Cytochrome P450-P1, EC 1.14.14.1, flavoprotein-linked monooxygenase, P1-450, P450-C, P450DX, subfamily I (aromatic compound-inducible), polypeptide 1, xenobiotic monooxygenase
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-460 of human Cytochrome P450 1A1 (NP_000490.1).,, Sequence:, NPYRYVVVSVTNVICAICFGRRYDHNHQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFG
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Breast Cancer, Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 1543
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.